C14ORF119 antibody (Chromosome 14 Open Reading Frame 119)

Details for Product anti-C14ORF119 Antibody No. ABIN4286030
Antigen
  • chromosome 14 open reading frame 119
  • C14orf119
Reactivity
Human
3
Host
Rabbit
3
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
3
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQ
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others C14ORF119 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name C14orf119
Background Gene Symbol: C14ORF119
Gene ID 55017
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Chromosome 14 Open Reading Frame 119 (C14ORF119) antibody (ABIN4286030) Immunohistochemistry-Paraffin: C14orf119 Antibody [NBP1-82164] - Staining of human ad...
Image no. 2 for anti-Chromosome 14 Open Reading Frame 119 (C14ORF119) antibody (ABIN4286030) Immunocytochemistry/Immunofluorescence: C14orf119 Antibody [NBP1-82164] - Staining of...
Image no. 3 for anti-Chromosome 14 Open Reading Frame 119 (C14ORF119) antibody (ABIN4286030) Western Blot: C14orf119 Antibody [NBP1-82164] - Lane 1: Marker [kDa] 250, 130, 95, 72...
Product cited in: Fagerberg, Oksvold, Skogs, Algenäs, Lundberg, Pontén, Sivertsson, Odeberg, Klevebring, Kampf, Asplund, Sjöstedt, Al-Khalili Szigyarto, Edqvist, Olsson, Rydberg, Hudson, Ottosson Takanen, Berling et al.: "Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). ..." in: Journal of proteome research, Vol. 12, Issue 6, pp. 2439-48, 2013 (PubMed).

Stadler, Hjelmare, Neumann, Jonasson, Pepperkok, Uhlén, Lundberg: "Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy." in: Journal of proteomics, Vol. 75, Issue 7, pp. 2236-51, 2012 (PubMed).

Did you look for something else?