CAMK2B antibody (Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta)

Details for Product anti-CAMK2B Antibody No. ABIN4287584, Supplier: Log in to see
Antigen
  • CAM2
  • CAMK2
  • CAMKB
  • Camk2d
  • Ck2b
  • camk2
  • camk2b
  • cam2
  • camkb
  • CAMK2B
  • calcium/calmodulin dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase II, beta
  • calcium/calmodulin-dependent protein kinase II beta
  • calcium/calmodulin dependent protein kinase (CaM kinase) II alpha S homeolog
  • calcium/calmodulin dependent protein kinase (CaM kinase) II beta L homeolog
  • calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
  • CAMK2B
  • Camk2b
  • camk2a.S
  • camk2b.L
Alternatives
anti-Human CAMK2B antibody for ELISA
Reactivity
Human, Mouse (Murine), Rat (Rattus)
117
79
78
7
7
6
5
5
4
4
4
3
3
1
1
1
1
1
Host
Rabbit
92
48
Clonality
Polyclonal
Conjugate
This CAMK2B antibody is un-conjugated
3
3
3
3
3
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
121
72
44
29
27
17
9
6
6
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others CAMK2B products on genomics-online (e.g. as negative or positive controls)
Antigen Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B)
Alternative Name CaMKII beta (CAMK2B Antibody Abstract)
Background Gene Symbol: CAMK2B
Gene ID 816
Pathways WNT Signaling, Interferon-gamma Pathway, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity
Application Notes Western Blot 1:500 - 1:1000, Simple Western 1:5, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500, In vivo assayFor HIER pH 6 retrieval is recommended. WB dilution: 1:100-1:500 (Rodent material) and 1:500-1:1000 (Human material). In Simple Western only 10-15 μL of the recommended dilution is used per data point.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (IHC) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of human lateral v...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the cor...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
 image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) In vivo assay: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Western Blotting (WB) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100,...
Did you look for something else?