CHST15 antibody (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15)

Details for Product anti-CHST15 Antibody No. ABIN4287709
Target
Reactivity
Human, Mouse, Rat
8
5
4
2
2
2
1
1
1
Host
Rabbit
7
1
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
7
2
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVER
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Target
Alternative Name Carbohydrate Sulfotransferase 15/CHST15 (CHST15 Antibody Abstract)
Background Gene Symbol: CHST15
Gene ID 51363
Pathways Glycosaminoglycan Metabolic Process
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200Immunohistochemistry retrieval recommended: HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images
Image no. 1 for anti-Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15) antibody (ABIN4287709) Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1...
Image no. 2 for anti-Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15) antibody (ABIN4287709) Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-88367] - Lane 1:...
Image no. 3 for anti-Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15) antibody (ABIN4287709) Western Blot: Carbohydrate Sulfotransferase 15/CHST15 Antibody [NBP1-88367] - Lane 1:...
Product cited in: Buniello, Hardisty-Hughes, Pass, Bober, Smith, Steel: "Headbobber: a combined morphogenetic and cochleosaccular mouse model to study 10qter deletions in human deafness." in: PLoS ONE, Vol. 8, Issue 2, pp. e56274, 2013 (PubMed).