Ceruloplasmin (Ferroxidase) (CP) antibody

Details for Product No. ABIN4297774
Antigen
Reactivity
Human
95
17
12
Host
Rabbit
75
15
11
6
4
Clonality
Polyclonal
Conjugate
Un-conjugated
13
7
7
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
76
58
39
20
17
15
12
12
12
9
7
7
3
2
2
1
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name Ceruloplasmin (CP Antibody Abstract)
Background Gene Symbol: CP
Gene ID 1356
UniProt P00450
Pathways Transition Metal Ion Homeostasis
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-P, HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Ceruloplasmin (Ferroxidase) (CP) antibody (ABIN4297774) Immunocytochemistry/Immunofluorescence: Ceruloplasmin Antibody [NBP1-88116] - Stainin...
Image no. 2 for anti-Ceruloplasmin (Ferroxidase) (CP) antibody (ABIN4297774) Immunohistochemistry-Paraffin: Ceruloplasmin Antibody [NBP1-88116] - Staining of huma...
Product cited in: Hametner, Wimmer, Haider, Pfeifenbring, Brück, Lassmann: "Iron and neurodegeneration in the multiple sclerosis brain." in: Annals of neurology, Vol. 74, Issue 6, pp. 848-61, 2014 (PubMed). Further details: Immunohistochemistry

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011 (PubMed).