CHMP4C antibody (Charged Multivesicular Body Protein 4C)

Details for Product anti-CHMP4C Antibody No. ABIN4298014, Supplier: Log in to see
Antigen
  • 2010012P02Rik
  • 2210015K02Rik
  • 2310010I16Rik
  • Shax3
  • Snf7-3
  • SNF7-3
  • VPS32C
  • zgc:110173
  • CHMP4c
  • chmp4c
  • charged multivesicular body protein 4C
  • charged multivesicular body protein 4C L homeolog
  • Chmp4c
  • CHMP4C
  • chmp4c
  • chmp4c.L
Reactivity
Human
13
3
3
1
1
1
1
1
1
1
Host
Rabbit
10
3
Clonality
Polyclonal
Conjugate
This CHMP4C antibody is un-conjugated
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
8
6
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others CHMP4C products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name CHMP4C (CHMP4C Antibody Abstract)
Background Gene Symbol: CHMP4C
Gene ID 92421
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Charged Multivesicular Body Protein 4C (CHMP4C) antibody (ABIN4298014) Western Blot: CHMP4C Antibody [NBP1-81166] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Charged Multivesicular Body Protein 4C (CHMP4C) antibody (ABIN4298014) Immunohistochemistry-Paraffin: CHMP4C Antibody [NBP1-81166] - Immunohistochemical sta...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Charged Multivesicular Body Protein 4C (CHMP4C) antibody (ABIN4298014) Immunohistochemistry-Paraffin: CHMP4C Antibody - Staining of human testis shows low ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Charged Multivesicular Body Protein 4C (CHMP4C) antibody (ABIN4298014) Immunohistochemistry-Paraffin: CHMP4C Antibody - Staining in human small intestine a...
Western Blotting (WB) image for anti-Charged Multivesicular Body Protein 4C (CHMP4C) antibody (ABIN4298014) Western Blot: CHMP4C Antibody - Analysis in control (vector only transfected HEK293T...
Did you look for something else?