Vacuolar Protein Sorting 13 Homolog A (S. Cerevisiae) (VPS13A) antibody

Details for Product No. ABIN4298101
Antigen
  • RGD1311340
  • CHAC
  • CHOREIN
  • 4930425F11
  • 4930516E05Rik
  • 4930543C13Rik
  • 9930023P20
  • Chac
  • Chorein
  • D330038K10Rik
  • mKIAA0986
  • vacuolar protein sorting 13 homolog A
  • chorein
  • Chorein
  • vacuolar protein sorting 13A
  • Vps13a
  • EHI_067970
  • GL50803_87358
  • VPS13A
Reactivity
Human
5
Host
Rabbit
5
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP)
3
2
1
1
1
1
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name Chorein (VPS13A Antibody Abstract)
Background Gene Symbol: VPS13A
Gene ID 23230
Application Notes Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended. Use in immunprecipitation reported in scientific literature (PMID 27468757)
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Vacuolar Protein Sorting 13 Homolog A (S. Cerevisiae) (VPS13A) antibody (ABIN4298101) Immunohistochemistry-Paraffin: Chorein Antibody - Staining of human duodenum shows m...
Image no. 2 for anti-Vacuolar Protein Sorting 13 Homolog A (S. Cerevisiae) (VPS13A) antibody (ABIN4298101) Immunohistochemistry-Paraffin: Chorein Antibody - Staining of human kidney shows str...
Image no. 3 for anti-Vacuolar Protein Sorting 13 Homolog A (S. Cerevisiae) (VPS13A) antibody (ABIN4298101) Immunohistochemistry-Paraffin: Chorein Antibody - Staining of human testis shows str...
Product cited in: Nishida, Nakamura, Urata, Kasamo, Hiwatashi, Yokoyama, Mizobuchi, Sakurai, Osaki, Morita, Watanabe, Yoshida, Yamane, Miyakoshi, Okiyama, Ueda, Wakasugi, Saitoh, Sakamoto, Takahashi, Shibano, Tokuoka et al.: "Novel pathogenic VPS13A gene mutations in Japanese patients with chorea-acanthocytosis. ..." in: Neurology. Genetics, Vol. 5, Issue 3, pp. e332, 2019 (PubMed). Method employed by authors: Western Blotting (WB) (Sample species: Human).

Nagata, Nakamura, Sakimoto, Urata, Sasaki, Shiokawa, Sano et al.: "Mouse model of chorea-acanthocytosis exhibits male infertility caused by impaired sperm motility as a result of ultrastructural morphological abnormalities in the mitochondrial sheath in the sperm ..." in: Biochemical and biophysical research communications, Vol. 503, Issue 2, pp. 915-920, 2018 (PubMed). (Sample species: Mouse (Murine)).

Kumar, Leonzino, Hancock-Cerutti, Horenkamp, Li, Lees, Wheeler, Reinisch, De Camilli: "VPS13A and VPS13C are lipid transport proteins differentially localized at ER contact sites." in: The Journal of cell biology, Vol. 217, Issue 10, pp. 3625-3639, 2018 (PubMed). Method employed by authors: Immunofluorescence (fixed cells) (IF/ICC) (Sample species: Human).

Sasaki, Nakamura, Kodama, Urata, Shiokawa, Hayashi, Sano: "Chorein interacts with α-tubulin and histone deacetylase 6, and overexpression preserves cell viability during nutrient deprivation in human embryonic kidney 293 cells." in: FASEB journal : official publication of the Federation of American Societies for Experimental Biology, Vol. 30, Issue 11, pp. 3726-3732, 2016 (PubMed). (Sample species: Human). Further details: Immunoprecipitation

Did you look for something else?