CLIC4 antibody (Chloride Intracellular Channel 4)

Details for Product anti-CLIC4 Antibody No. ABIN4299203, Supplier: Log in to see
Antigen
  • CLIC4L
  • H1
  • MTCLIC
  • huH1
  • p64H1
  • cb142
  • wu:fb33c05
  • wu:fc30h10
  • clic4
  • MGC89006
  • CLIC4
  • DKFZp459A0325
  • D0Jmb3
  • TU-74
  • mc3s5
  • mtCLIC
  • xclic4
  • chloride intracellular channel 4
  • chloride intracellular channel 4 (mitochondrial)
  • chloride intracellular channel 4 S homeolog
  • CLIC4
  • Clic4
  • clic4
  • clic4.S
Reactivity
Human
105
70
61
4
4
3
1
1
1
1
1
Host
Rabbit
92
21
6
Clonality
Polyclonal
Conjugate
This CLIC4 antibody is un-conjugated
11
5
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
104
55
52
25
24
13
8
7
5
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others CLIC4 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name CLIC4 (CLIC4 Antibody Abstract)
Background Gene Symbol: CLIC4
Gene ID 25932
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Chloride Intracellular Channel 4 (CLIC4) antibody (ABIN4299203) Western Blot: CLIC4 Antibody [NBP1-85574] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunofluorescence (IF) image for anti-Chloride Intracellular Channel 4 (CLIC4) antibody (ABIN4299203) Immunocytochemistry/Immunofluorescence: CLIC4 Antibody [NBP1-85574] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chloride Intracellular Channel 4 (CLIC4) antibody (ABIN4299203) Immunohistochemistry-Paraffin: CLIC4 Antibody [NBP1-85574] - Staining of human kidney...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chloride Intracellular Channel 4 (CLIC4) antibody (ABIN4299203) Immunohistochemistry-Paraffin: CLIC4 Antibody - Staining of human skeletal muscle sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chloride Intracellular Channel 4 (CLIC4) antibody (ABIN4299203) Immunohistochemistry-Paraffin: CLIC4 Antibody - Staining in human kidney and skeleta...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chloride Intracellular Channel 4 (CLIC4) antibody (ABIN4299203) Immunohistochemistry-Paraffin: CLIC4 Antibody - Staining of human kidney shows high ...
Product cited in: Yan, Zhang, Hu, Ma, Hou, Zhang, Wang, Gao, Shen, Lv, Ohtsu, Han, Wang, Chen: "Histamine H3 receptors aggravate cerebral ischaemic injury by histamine-independent mechanisms." in: Nature communications, Vol. 5, pp. 3334, 2014 (PubMed).

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Lomnytska, Becker, Gemoll, Lundgren, Habermann, Olsson, Bodin, Engström, Hellman, Hellman, Hellström, Andersson, Mints, Auer: "Impact of genomic stability on protein expression in endometrioid endometrial cancer." in: British journal of cancer, Vol. 106, Issue 7, pp. 1297-305, 2012 (PubMed).

Did you look for something else?