Complement Factor B antibody (CFB)

Details for Product anti-CFB Antibody No. ABIN4299963, Supplier: Log in to see
Antigen
  • AHUS4
  • BF
  • BFD
  • CFAB
  • FB
  • FBI12
  • GBG
  • H2-Bf
  • PBF2
  • bf
  • Bf-1
  • Brre-Bf
  • zgc:114032
  • Bf
  • Sp152
  • bfb-A
  • Bf B
  • LOC397725
  • bf/c2
  • CFB
  • AI195813
  • AI255840
  • B
  • C2
  • Fb
  • Da1-24
  • complement factor B
  • complement factor B S homeolog
  • complement factor B L homeolog
  • CFB
  • cfb
  • bf
  • cfb.S
  • cfb.L
  • bf/c2
  • LOC100555981
  • Cfb
Alternatives
anti-Human Complement Factor B antibody for Immunohistochemistry (Frozen Sections)
Reactivity
Human
205
57
48
2
1
1
1
1
1
Host
Rabbit
139
85
13
5
1
Clonality
Polyclonal
Conjugate
This Complement Factor B antibody is un-conjugated
28
20
12
4
4
3
3
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
177
129
65
29
21
20
17
14
13
13
12
7
6
4
3
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others Complement Factor B products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name Complement Factor B (CFB Antibody Abstract)
Background Gene Symbol: CFB
Gene ID 629
Pathways Complement System, Proton Transport, Ribonucleoside Biosynthetic Process
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Complement Factor B (CFB) antibody (ABIN4299963) Immunohistochemistry: Complement Factor B Antibody [NBP1-89986] - Staining of human p...
Product cited in: Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011 (PubMed).

Singh, Kapoun, Higgins, Kutschke, Thurman, Zhang, Singh, Yang, Guan, Lowe, Weiss, Zimmermann, Yull, Blackwell, Mohler, Anderson: "Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart." in: The Journal of clinical investigation, Vol. 119, Issue 4, pp. 986-96, 2009 (PubMed).

Did you look for something else?