Carboxypeptidase, Vitellogenic-Like (CPVL) antibody

Details for Product No. ABIN4300349, Supplier: Log in to see
Antigen
  • cb1084
  • wu:fb69d02
  • CPVL
  • cpvl
  • Cpvl
  • ACYPI000011
  • DKFZp469A0432
  • HVLP
  • 4933436L16Rik
  • carboxypeptidase, vitellogenic-like
  • carboxypeptidase, vitellogenic like
  • probable serine carboxypeptidase CPVL
  • carboxypeptidase, vitellogenic-like L homeolog
  • cpvl
  • CPVL
  • LOC534518
  • cpvl.L
  • Cpvl
Reactivity
Human
52
6
6
2
2
2
1
1
Host
Rabbit
34
18
Clonality
Polyclonal
Conjugate
Un-conjugated
3
3
3
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
41
23
17
10
9
7
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG
Purification Immunogen affinity purified
Alternative Name CPVL (CPVL Antibody Abstract)
Background Gene Symbol: CPVL
Gene ID 54504
UniProt Q9H3G5
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Carboxypeptidase, Vitellogenic-Like (CPVL) antibody (ABIN4300349) Immunohistochemistry: CPVL Antibody [NBP2-38546] - Staining of human kidney shows str...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Carboxypeptidase, Vitellogenic-Like (CPVL) antibody (ABIN4300349) Immunohistochemistry-Paraffin: CPVL Antibody - Staining of human spleen shows strong...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Carboxypeptidase, Vitellogenic-Like (CPVL) antibody (ABIN4300349) Immunohistochemistry-Paraffin: CPVL Antibody - Staining of human pancreas shows low ...
Did you look for something else?