CSRP3 antibody (Cysteine and Glycine-Rich Protein 3)

Details for Product anti-CSRP3 Antibody No. ABIN4300721, Supplier: Log in to see
  • CLP
  • CMD1M
  • CMH12
  • CRP3
  • LMO4
  • MLP
  • MMLP
  • csrp3
  • zgc:103468
  • CSRP3
  • csrp3-a
  • cysteine and glycine rich protein 3
  • cysteine and glycine-rich protein 3
  • cysteine and glycine-rich protein 3 (cardiac LIM protein)
  • cysteine and glycine rich protein 3 L homeolog
  • CSRP3
  • Csrp3
  • csrp3
  • csrp3.L
This CSRP3 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGK SVYA
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others CSRP3 products on genomics-online (e.g. as negative or positive controls)
Alternative Name CSRP3 (CSRP3 Antibody Abstract)
Background Gene Symbol: CSRP3
Gene ID 8048
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) antibody (ABIN4300721) Western Blot: CSRP3 Antibody [NBP2-13880] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) antibody (ABIN4300721) Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP2-13880] - Staining of human heart ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) antibody (ABIN4300721) Immunohistochemistry-Paraffin: CSRP3 Antibody - Staining of human prostate shows low...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) antibody (ABIN4300721) Immunohistochemistry-Paraffin: CSRP3 Antibody - Staining in human heart muscle and p...
Did you look for something else?