DCAF11 antibody (DDB1 and CUL4 Associated Factor 11)

Details for Product anti-DCAF11 Antibody No. ABIN4304464, Supplier: Log in to see
Antigen
  • wdr23
  • MGC53214
  • MGC88880
  • WDR23
  • zgc:110066
  • DKFZP459A2062
  • PRO2389
  • 0710008A13Rik
  • C76035
  • D14Ucla1
  • Dacf11
  • GLO14
  • Wdr23
  • DDB1 and CUL4 associated factor 11 L homeolog
  • DDB1 and CUL4 associated factor 11
  • ddb1 and cul4 associated factor 11
  • dcaf11.L
  • dcaf11
  • DCAF11
  • Dcaf11
Reactivity
Human
26
21
21
4
4
3
3
3
2
2
1
1
1
1
Host
Rabbit
26
Clonality
Polyclonal
Conjugate
This DCAF11 antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
14
13
4
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDG
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others DCAF11 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name DCAF11 (DCAF11 Antibody Abstract)
Background Gene Symbol: DCAF11
Gene ID 80344
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-DDB1 and CUL4 Associated Factor 11 (DCAF11) antibody (ABIN4304464) Immunocytochemistry/Immunofluorescence: DCAF11 Antibody [NBP1-83364] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DDB1 and CUL4 Associated Factor 11 (DCAF11) antibody (ABIN4304464) Immunohistochemistry-Paraffin: DCAF11 Antibody [NBP1-83364] - Staining of human kidne...
Western Blotting (WB) image for anti-DDB1 and CUL4 Associated Factor 11 (DCAF11) antibody (ABIN4304464) Western Blot: DCAF11 Antibody [NBP1-83364] - Image from verified customer review.
Western Blotting (WB) image for anti-DDB1 and CUL4 Associated Factor 11 (DCAF11) antibody (ABIN4304464) Western Blot: DCAF11 Antibody [NBP1-83364] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunofluorescence (IF) image for anti-DDB1 and CUL4 Associated Factor 11 (DCAF11) antibody (ABIN4304464) Immunocytochemistry/Immunofluorescence: DCAF11 Antibody - Immunofluorescent staining...
Did you look for something else?