DDX3X antibody (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked)

Details for Product anti-DDX3X Antibody No. ABIN4304628
Antigen
  • DBX
  • DDX14
  • DDX3
  • HLP2
  • D1Pas1-rs2
  • Ddx3
  • Fin14
  • An3
  • pl10
  • DDX3X
  • DEAD-box helicase 3, X-linked
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked
  • DEAD-box helicase 3, X-linked L homeolog
  • DDX3X
  • Ddx3x
  • ddx3x.L
  • ddx3x
Alternatives
anti-Human DDX3X antibody for Immunoprecipitation
Reactivity
Human, Mouse (Murine), Rat (Rattus)
179
108
89
6
6
5
5
4
4
1
1
1
1
Host
Rabbit
160
19
Clonality
Polyclonal
Conjugate
This DDX3X antibody is un-conjugated
7
6
6
3
3
3
3
3
3
3
3
3
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
133
71
63
30
27
26
23
17
8
6
5
5
2
2
1
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others DDX3X products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name DDX3 (DDX3X Antibody Abstract)
Background Gene Symbol: DDX3X
Gene ID 1654
Pathways Ribonucleoprotein Complex Subunit Organization, Positive Regulation of Endopeptidase Activity, Negative Regulation of intrinsic apoptotic Signaling, Ribosome Assembly
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunocytochemistry/Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mous...
Western Blotting (WB) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Western Blot: DDX3 Antibody [NBP1-85291] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human appendi...
Western Blotting (WB) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Western Blot: DDX3 Antibody [NBP1-85291] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55...
Immunofluorescence (IF) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunocytochemistry/Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mous...
Western Blotting (WB) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Western Blot: DDX3 Antibody [NBP1-85291] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human cerebra...
Immunofluorescence (IF) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunocytochemistry/Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of huma...
Immunofluorescence (IF) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunocytochemistry/Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mous...
Immunofluorescence (IF) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunocytochemistry/Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mous...
Immunofluorescence (IF) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunocytochemistry/Immunofluorescence: DDX3 Antibody [NBP1-85291] - Staining of mous...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human hippoca...
Western Blotting (WB) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Western Blot: DDX3 Antibody [NBP1-85291] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody [NBP1-85291] - Staining of human cerebel...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunocytochemistry/Immunofluorescence: DDX3 Antibody - Immunofluorescent staining o...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody - Staining of human cerebellum shows mo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody - Staining of human cerebral cortex sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody - Staining of human Fallopian tube show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody - Staining of human hippocampus shows m...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody - Staining of human tonsil shows modera...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody - Staining of mouse cerebral cortex sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Immunohistochemistry-Paraffin: DDX3 Antibody - Staining of mouse hippocampus shows m...
Western Blotting (WB) image for anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, X-Linked (DDX3X) antibody (ABIN4304628) Western Blot: DDX3 Antibody - Analysis: ABIN4304628 (A) shows similar pattern to ind...
Product cited in: Phung, Cieśla, Sanna, Guzzi, Beneventi, Cao Thi Ngoc, Lauss, Cabrita, Cordero, Bosch, Rosengren, Häkkinen, Griewank, Paschen, Harbst, Olsson, Ingvar, Carneiro, Tsao, Schadendorf, Pietras, Bellodi et al.: "The X-Linked DDX3X RNA Helicase Dictates Translation Reprogramming and Metastasis in Melanoma. ..." in: Cell reports, Vol. 27, Issue 12, pp. 3573-3586.e7, 2019 (PubMed).

Hagerstrand, Tong, Schumacher, Ilic, Shen, Cheung, Vazquez, Shrestha, Kim, Giacomelli, Rosenbluh, Schinzel, Spardy, Barbie, Mermel, Weir, Garraway, Tamayo, Mesirov, Beroukhim, Hahn: "Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers." in: Cancer discovery, Vol. 3, Issue 9, pp. 1044-57, 2013 (PubMed). Further details: Western Blotting

Stadler, Hjelmare, Neumann, Jonasson, Pepperkok, Uhlén, Lundberg: "Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy." in: Journal of proteomics, Vol. 75, Issue 7, pp. 2236-51, 2012 (PubMed).

Mulder, Björling, Jonasson, Wernérus, Hober, Hökfelt, Uhlén: "Tissue profiling of the mammalian central nervous system using human antibody-based proteomics." in: Molecular & cellular proteomics : MCP, Vol. 8, Issue 7, pp. 1612-22, 2009 (PubMed).

Did you look for something else?