DUS3L antibody (Dihydrouridine Synthase 3-Like (S. Cerevisiae))

Details for Product anti-DUS3L Antibody No. ABIN4306382, Supplier: Log in to see
Antigen
  • DUS3
  • AI662135
  • AW557805
  • dihydrouridine synthase 3-like L homeolog
  • dihydrouridine synthase 3 like
  • dihydrouridine synthase 3-like (S. cerevisiae)
  • dihydrouridine synthase 3-like
  • dus3l.L
  • DUS3L
  • Dus3l
Reactivity
Human
19
6
6
2
1
1
1
Host
Rabbit
18
1
Clonality
Polyclonal
Conjugate
This DUS3L antibody is un-conjugated
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
14
9
8
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYV
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others DUS3L products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name DUS3L (DUS3L Antibody Abstract)
Background Gene Symbol: DUS3L
Gene ID 56931
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Dihydrouridine Synthase 3-Like (S. Cerevisiae) (DUS3L) antibody (ABIN4306382) Immunocytochemistry/Immunofluorescence: DUS3L Antibody [NBP1-84043] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dihydrouridine Synthase 3-Like (S. Cerevisiae) (DUS3L) antibody (ABIN4306382) Immunohistochemistry-Paraffin: DUS3L Antibody [NBP1-84043] - Staining of human rectum...
Product cited in: Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Did you look for something else?