Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

DUSP19 antibody (Dual Specificity Phosphatase 19) Primary Antibody

DUSP19 Reactivity: Human ICC, IF, IHC, IHC (p), WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN4306401
Contact our Customer Service for availability and price in your country.
  • Target
    Reactivity
    Human
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This DUSP19 antibody is un-conjugated
    Application
    Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Specificity
    Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
    Purification
    Immunogen affinity purified
    Immunogen
    This antibody was developed against Recombinant Protein corresponding to amino acids:QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
    Isotype
    IgG
  • Application Notes
    Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
    Comment

    The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    PBS ( pH 7.2) and 40 % Glycerol
    Buffer contains: 0.02 % Sodium Azide
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
  • Target
    Alternative Name
    DUSP19 (DUSP19 Antibody Abstract)
    Synonyms
    Dusp19, skrp1, dusp17, ts-dsp1, MGC85046, si:dkey-237j22.1, DKFZp469B171, DUSP17, LMWDSP3, SKRP1, TS-DSP1, 5930436K22Rik, C79103, dual specificity phosphatase 19b, dual specificity phosphatase 19, dual specificity phosphatase 19 L homeolog, dual specificity phosphatase 19a, dusp19b, DUSP19, dusp19, dusp19.L, dusp19a, Dusp19
    Background
    Gene Symbol: DUSP19
    Gene ID
    142679
You are here: