DUSP19 antibody (Dual Specificity Phosphatase 19) Primary Antibody
-
- Target
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- This DUSP19 antibody is un-conjugated
- Application
- Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Specificity
- Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
- Purification
- Immunogen affinity purified
- Immunogen
- This antibody was developed against Recombinant Protein corresponding to amino acids:QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
- Isotype
- IgG
-
anti-Dual Specificity Phosphatase 19 (DUSP19) (Center) antibody Primary Antibody
DUSP19 Reactivity: Human IHC (p), WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (AA 111-160) antibody Primary AntibodyDUSP19 Reactivity: Human IF, ELISA, WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) antibody Primary AntibodyDUSP19 Reactivity: Human ELISA, ICC, IF, WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (Internal Region) antibody Primary AntibodyDUSP19 Reactivity: Human, Monkey ELISA, IF, WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (N-Term) antibody Primary AntibodyDUSP19 Reactivity: Rat WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (C-Term) antibody Primary AntibodyDUSP19 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (N-Term) antibody Primary AntibodyDUSP19 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (C-Term) antibody Primary AntibodyDUSP19 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (AA 100-150) antibody Primary AntibodyDUSP19 Reactivity: Human, Mouse, Rat IF, IHC, WB Host: Rabbit Polyclonal unconjugated
anti-Dual Specificity Phosphatase 19 (DUSP19) (AA 1-217) antibody Primary AntibodyDUSP19 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
-
- Application Notes
- Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
- Comment
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide - Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
-
- Target
- Alternative Name
- DUSP19 (DUSP19 Antibody Abstract)
- Synonyms
- Dusp19, skrp1, dusp17, ts-dsp1, MGC85046, si:dkey-237j22.1, DKFZp469B171, DUSP17, LMWDSP3, SKRP1, TS-DSP1, 5930436K22Rik, C79103, dual specificity phosphatase 19b, dual specificity phosphatase 19, dual specificity phosphatase 19 L homeolog, dual specificity phosphatase 19a, dusp19b, DUSP19, dusp19, dusp19.L, dusp19a, Dusp19
- Background
- Gene Symbol: DUSP19
- Gene ID
- 142679