Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Alternatives

Options

Supplier

Supplier Product No.

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

2 references available

Available images

Western Blotting (WB) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043)

Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043)

Immunofluorescence (IF) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043)

Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043)

Catalog No. ABIN4313043

Contact our Customer Service for availability and price in your country.

Purchasing Process

Order hotline:

+1 877 302 8632
+1 888 205 9894 (TF)

Catalog No. ABIN4313043

Contact our Customer Service for availability and price in your country.

Purchasing Process

Order hotline:

+1 877 302 8632
+1 888 205 9894 (TF)

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

2 references available

Product Details anti-G3BP2 Antibody References Images Handling Application Details Target Details back to top
Product Details anti-G3BP2 Antibody Show Hide
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Isotype	IgG
Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification	Immunogen affinity purified
Plasmids, Primers & others	G3BP2 products on genomics-online (e.g. as negative or positive controls)

Target Details G3BP2 References Images Handling Application Details back to top
Target Details G3BP2 Show Hide
Antigen
Alternative Name	G3BP2 (G3BP2 Antibody Abstract)
Background	Gene Symbol: G3BP2
Gene ID	9908
Pathways	Maintenance of Protein Location

Application Details References Images Handling Target Details back to top
Application Details Show Hide
Application Notes	Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment	The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.
Restrictions	For Research Use only

Handling References Images Application Details Target Details back to top
Handling Show Hide
Format	Liquid
Buffer	PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide
Preservative	Sodium azide
Precaution of Use	This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage	4 °C,-20 °C
Storage Comment	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images References Handling Application Details Target Details back to top
Images Show Hide
Supplier Images	Western Blot: G3BP2 Antibody [NBP1-82976] - Lane 1: NIH-3T3 cell lysate (Mouse embryo... Western Blot: G3BP2 Antibody [NBP1-82976] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56... Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Immunohistochemical stai... Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82976] - Staining of hum... Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human cerebral cortex sh... Immunofluorescence: G3BP2 Antibody - G3BP2 staning is detected in neurites and cell ... Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining in human cerebral cortex an... Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human skin shows low exp... Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human cerebellum shows s... Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human testis shows moder... Images for product: anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody Western Blot: G3BP2 Antibody [NBP1-82976] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) Western Blot: G3BP2 Antibody [NBP1-82976] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11.Lane 2: Human cell line RT-4.Lane 3: Human cell line U-251MG sp Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells. Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82976] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells. Immunofluorescence: G3BP2 Antibody - G3BP2 staning is detected in neurites and cell bodies in mouse cortical neuros (dilution: 1:500 , DAPI: blue). This image was submitted via customer Review. Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining in human cerebral cortex and skin tissues using anti-G3BP2 antibody. Corresponding G3BP2 RNA-seq data are presented for the same tissues. Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human skin shows low expression as expected. Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in molecular layer. Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

References for anti-G3BP2 antibody (ABIN4313043) Images Handling Application Details Target Details back to top
References for anti-G3BP2 antibody (ABIN4313043) Show Hide
Product cited in:	De Marchi, Liu, Stingl, Timmermans, Smid, Look, Tjoa, Braakman, Opdam, Linn, Sweep, Span, Kliffen, Luider, Foekens, Martens, Umar: "4-protein signature predicting tamoxifen treatment outcome in recurrent breast cancer." in: Molecular oncology, Vol. 10, Issue 1, pp. 24-39, 2016 (PubMed). Method employed by authors: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (Sample species: Human). Wei, Fattet, Tsai, Guo, Pai, Majeski, Chen, Sah, Taylor, Engler, Yang: "Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway." in: Nature cell biology, Vol. 17, Issue 5, pp. 678-88, 2015 (PubMed). (Sample species: Mouse (Murine)). Further details: Western Blotting,Immunohistochemistry

More product categories related to G3BP2 Primary antibodies

Did you look for something else?

Catalog No. ABIN4313043

Contact our Customer Service for availability and price in your country.

Purchasing Process

Order hotline:

+1 877 302 8632
+1 888 205 9894 (TF)

Phone:	+1 877 302 8632
Fax:	+1 888 205 9894 (Toll-free)
E-Mail:	orders@antibodies-online.com