G3BP2 antibody (GTPase Activating Protein (SH3 Domain) Binding Protein 2)

Details for Product anti-G3BP2 Antibody No. ABIN4313043, Supplier: Log in to see
  • wu:fb43h08
  • wu:fc13c01
  • wu:fe25b02
  • zgc:158370
  • AA409541
  • E430034L04Rik
  • G3BP
  • mKIAA0660
  • RGD1309571
  • GTPase activating protein (SH3 domain) binding protein 2
  • G3BP stress granule assembly factor 1
  • G3BP stress granule assembly factor 2
  • g3bp2
  • g3bp1
  • G3BP2
  • G3bp2
anti-Mouse (Murine) G3BP2 antibody for Immunocytochemistry
Human, Mouse (Murine), Rat (Rattus)
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others G3BP2 products on genomics-online (e.g. as negative or positive controls)
Alternative Name G3BP2 (G3BP2 Antibody Abstract)
Background Gene Symbol: G3BP2
Gene ID 9908
Pathways Maintenance of Protein Location
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Western Blot: G3BP2 Antibody [NBP1-82976] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Western Blotting (WB) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Western Blot: G3BP2 Antibody [NBP1-82976] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82976] - Immunohistochemical stai...
Immunofluorescence (IF) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82976] - Staining of hum...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human cerebral cortex sh...
Immunofluorescence (IF) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunofluorescence: G3BP2 Antibody - G3BP2 staning is detected in neurites and cell ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining in human cerebral cortex an...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human skin shows low exp...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human cerebellum shows s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human testis shows moder...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase Activating Protein (SH3 Domain) Binding Protein 2 (G3BP2) antibody (ABIN4313043) Immunohistochemistry-Paraffin: G3BP2 Antibody - Staining of human cerebellum, cerebr...
Product cited in: De Marchi, Liu, Stingl, Timmermans, Smid, Look, Tjoa, Braakman, Opdam, Linn, Sweep, Span, Kliffen, Luider, Foekens, Martens, Umar: "4-protein signature predicting tamoxifen treatment outcome in recurrent breast cancer." in: Molecular oncology, Vol. 10, Issue 1, pp. 24-39, 2016 (PubMed). Method employed by authors: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (Sample species: Human).

Wei, Fattet, Tsai, Guo, Pai, Majeski, Chen, Sah, Taylor, Engler, Yang: "Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway." in: Nature cell biology, Vol. 17, Issue 5, pp. 678-88, 2015 (PubMed). (Sample species: Mouse (Murine)). Further details: Western Blotting,Immunohistochemistry

Did you look for something else?