gamma-Glutamylcyclotransferase (GGCT) antibody

Details for Product No. ABIN4313404
Antigen
  • fj35c05
  • ggct
  • wu:fj35b07
  • wu:fj35c05
  • zgc:56140
  • A030007L17Rik
  • AA673177
  • Gctg
  • Ggc
  • Ggctl1
  • RGD1304876
  • RGD1562590
  • C7orf24
  • CRF21
  • GCTG
  • GGC
  • gamma-glutamylcyclotransferase b
  • gamma-glutamylcyclotransferase
  • gamma-glutamyl cyclotransferase
  • ggctb
  • GGCT
  • ggct
  • Ggct
Reactivity
Human
66
22
22
1
1
1
1
1
Host
Rabbit
64
1
1
Clonality
Polyclonal
Conjugate
Un-conjugated
4
4
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
46
25
14
13
8
4
3
3
3
2
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name gamma-Glutamylcyclotransferase/CRF21/GGCT (GGCT Antibody Abstract)
Background Gene Symbol: GGCT
Molecular Weight Theoretical MW: 21 kDa
Gene ID 79017
UniProt O75223
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-gamma-Glutamylcyclotransferase (GGCT) antibody (ABIN4313404) Western Blot: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody [NBP1-86727] - Lane ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-gamma-Glutamylcyclotransferase (GGCT) antibody (ABIN4313404) Immunohistochemistry-Paraffin: gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody [NB...
Product cited in: Amano, Eishi, Yamada, Uchida, Minegishi, Tamura, Kobayashi, Hiroshi, Suzuki, Board: "Widespread expression of γ-glutamyl cyclotransferase suggests it is not a general tumor marker." in: The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, Vol. 60, Issue 1, pp. 76-86, 2011 (PubMed).

Gromov, Gromova, Friis, Timmermans-Wielenga, Rank, Simon, Sauter, Moreira: "Proteomic profiling of mammary carcinomas identifies C7orf24, a gamma-glutamyl cyclotransferase, as a potential cancer biomarker." in: Journal of proteome research, Vol. 9, Issue 8, pp. 3941-53, 2010 (PubMed).

Did you look for something else?