GTPase, IMAP Family Member 2 (GIMAP2) antibody

Details for Product No. ABIN4314117, Supplier: Log in to see
  • GIMAP5
  • HIMAP2
  • IMAP2
  • GTPase, IMAP family member 2
  • GIMAP2
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTA
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name GIMAP2 (GIMAP2 Antibody Abstract)
Background Gene Symbol: GIMAP2
Gene ID 26157
Research Area Signaling
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-GTPase, IMAP Family Member 2 (GIMAP2) antibody (ABIN4314117) Immunocytochemistry/Immunofluorescence: GIMAP2 Antibody [NBP1-85071] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GTPase, IMAP Family Member 2 (GIMAP2) antibody (ABIN4314117) Immunohistochemistry-Paraffin: GIMAP2 Antibody [NBP1-85071] - Immunohistochemical sta...
Western Blotting (WB) image for anti-GTPase, IMAP Family Member 2 (GIMAP2) antibody (ABIN4314117) Western Blot: GIMAP2 Antibody [NBP1-85071] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-GTPase, IMAP Family Member 2 (GIMAP2) antibody (ABIN4314117) Immunohistochemistry-Paraffin: GIMAP2 Antibody - Staining of human appendix shows st...
Did you look for something else?