Golgi Membrane Protein 1 (GOLM1) antibody

Details for Product No. ABIN4315385, Supplier: Log in to see
Antigen
  • C9orf155
  • GOLPH2
  • GP73
  • PSEC0257
  • bA379P1.3
  • 2310001L02Rik
  • AW125446
  • D030064E01Rik
  • Golph2
  • GOLM1
  • golph2
  • gp73
  • golgi membrane protein 1
  • Golgi membrane protein 1
  • golgi membrane protein 1 L homeolog
  • GOLM1
  • Golm1
  • golm1
  • LOC100400549
  • golm1.L
Reactivity
Human
160
22
14
8
2
2
2
1
1
1
1
1
1
Host
Rabbit
94
54
18
Clonality
Polyclonal
Conjugate
Un-conjugated
12
10
6
2
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
129
97
73
46
43
15
12
7
4
4
3
3
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name GOLM1 (GOLM1 Antibody Abstract)
Background Gene Symbol: GOLM1
Gene ID 51280
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Golgi Membrane Protein 1 (GOLM1) antibody (ABIN4315385) Western Blot: GOLM1 Antibody [NBP1-88775] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunofluorescence (IF) image for anti-Golgi Membrane Protein 1 (GOLM1) antibody (ABIN4315385) Immunocytochemistry/Immunofluorescence: GOLM1 Antibody [NBP1-88775] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Golgi Membrane Protein 1 (GOLM1) antibody (ABIN4315385) Immunohistochemistry-Paraffin: GOLM1 Antibody [NBP1-88775] - Staining of human colon ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Golgi Membrane Protein 1 (GOLM1) antibody (ABIN4315385) Immunohistochemistry-Paraffin: GOLM1 Antibody - Staining of human prostate shows str...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Golgi Membrane Protein 1 (GOLM1) antibody (ABIN4315385) Immunohistochemistry-Paraffin: GOLM1 Antibody - Staining of human skeletal muscle sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Golgi Membrane Protein 1 (GOLM1) antibody (ABIN4315385) Immunohistochemistry-Paraffin: GOLM1 Antibody - Staining in human stomach and skelet...
Product cited in: Kojima, Enokida, Yoshino, Itesako, Chiyomaru, Kinoshita, Fuse, Nishikawa, Goto, Naya, Nakagawa, Seki: "The tumor-suppressive microRNA-143/145 cluster inhibits cell migration and invasion by targeting GOLM1 in prostate cancer." in: Journal of human genetics, Vol. 59, Issue 2, pp. 78-87, 2014 (PubMed).

Goto, Kojima, Nishikawa, Enokida, Chiyomaru, Kinoshita, Nakagawa, Naya, Ichikawa, Seki: "The microRNA-23b/27b/24-1 cluster is a disease progression marker and tumor suppressor in prostate cancer." in: Oncotarget, Vol. 5, Issue 17, pp. 7748-59, 2014 (PubMed). (Sample species: Human). Further details: Western Blotting

Did you look for something else?