HIP1 antibody (Huntingtin Interacting Protein 1)

Details for Product anti-HIP1 Antibody No. ABIN4317501, Supplier: Log in to see
Antigen
  • CG10971
  • Dmel\\CG10971
  • Hip1R
  • hip1
  • MGC78813
  • HIP-I
  • ILWEQ
  • 2610109B09Rik
  • A930014B11Rik
  • E130315I21Rik
  • mKIAA4113
  • huntingtin interacting protein 1
  • Huntingtin interacting protein 1
  • huntingtin interacting protein 1 related L homeolog
  • HIP1
  • Hip1
  • hip1r.L
  • hip1
Alternatives
anti-Human HIP1 antibody for Western Blotting
Reactivity
Human, Mouse (Murine), Rat (Rattus)
55
15
8
3
3
2
2
2
1
1
1
Host
Rabbit
31
26
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
55
25
21
9
8
6
2
2
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others HIP1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name HIP1 (HIP1 Antibody Abstract)
Background Gene Symbol: HIP1
Gene ID 3092
Pathways Positive Regulation of Endopeptidase Activity
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunocytochemistry/Immunofluorescence: HIP1 Antibody [NBP1-81592] - Staining of huma...
Western Blotting (WB) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Western Blot: HIP1 Antibody [NBP1-81592] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human epididy...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Staining of human testis shows cytopl...
Western Blotting (WB) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Western Blot: HIP1 Antibody - Analysis in human cell lines A-549 and Caco-2 using An...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Analysis in human testis and liver ti...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Staining in human testis and liver ti...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Huntingtin Interacting Protein 1 (HIP1) antibody (ABIN4317501) Immunohistochemistry-Paraffin: HIP1 Antibody - Staining of human liver shows low exp...
Product cited in: Majeed, Vasudevan, Chen, Luo, Torres, Evans, Sharkey, Foraker, Wong, Esk, Freeman, Moffett, Keen, Brodsky: "Clathrin light chains are required for the gyrating-clathrin recycling pathway and thereby promote cell migration." in: Nature communications, Vol. 5, pp. 3891, 2014 (PubMed).

Did you look for something else?