MAPKBP1 antibody (Mitogen-Activated Protein Kinase Binding Protein 1)

Details for Product anti-MAPKBP1 Antibody No. ABIN4332694
  • MGC83682
  • JNKBP-1
  • 2810483F24Rik
  • AW123212
  • Jnkbp1
  • mKIAA0596
  • mitogen-activated protein kinase binding protein 1 L homeolog
  • mitogen-activated protein kinase binding protein 1
  • mitogen activated protein kinase binding protein 1
  • mapkbp1.L
  • Mapkbp1
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLSVDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSPQTPDQEQFLKQHFETLA
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others MAPKBP1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name MAPKBP1 (MAPKBP1 Antibody Abstract)
Background Gene Symbol: MAPKBP1
Gene ID 23005
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Mitogen-Activated Protein Kinase Binding Protein 1 (MAPKBP1) antibody (ABIN4332694) Immunocytochemistry/Immunofluorescence: MAPKBP1 Antibody [NBP1-82984] - Staining of h...
Image no. 2 for anti-Mitogen-Activated Protein Kinase Binding Protein 1 (MAPKBP1) antibody (ABIN4332694) Immunohistochemistry-Paraffin: MAPKBP1 Antibody [NBP1-82984] - Immunohistochemical st...
Product cited in: Lecat, Di Valentin, Somja, Jourdan, Fillet, Kufer, Habraken, Sadzot, Louis, Delvenne, Piette, Legrand-Poels: "The c-Jun N-terminal kinase (JNK)-binding protein (JNKBP1) acts as a negative regulator of NOD2 protein signaling by inhibiting its oligomerization process." in: The Journal of biological chemistry, Vol. 287, Issue 35, pp. 29213-26, 2012 (PubMed).

Did you look for something else?