MPST antibody (Mercaptopyruvate Sulfurtransferase)

Details for Product anti-MPST Antibody No. ABIN4335380
Antigen
  • MST
  • TST2
  • Mst
  • mst
  • tst
  • tst2
  • fa96h11
  • mpst
  • wu:fa96h11
  • mercaptopyruvate sulfurtransferase
  • zgc:162544
  • mercaptopyruvate sulfurtransferase L homeolog
  • mercaptopyruvate sulfurtransferase S homeolog
  • MPST
  • Mpst
  • mpst
  • zgc:162544
  • sseA
  • mpst.L
  • mpst.S
Reactivity
Human, Mouse (Murine)
30
7
3
2
2
2
2
2
1
1
1
Host
Rabbit
27
7
Clonality
Polyclonal
Conjugate
This MPST antibody is un-conjugated
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
27
9
6
6
6
4
2
1
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others MPST products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name MPST (MPST Antibody Abstract)
Background Gene Symbol: MPST
Molecular Weight Theoretical MW: 33 kDa
Gene ID 4357
UniProt P25325
Application Notes Western Blot 1:100-1:500, Simple Western 1:20, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Simple Western (SimWes) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of correspondi...
Simple Western (SimWes) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of correspondi...
Western Blotting (WB) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Western Blot: MPST Antibody [NBP1-82617] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32,...
Simple Western (SimWes) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Simple Western: MPST Antibody [NBP1-82617] - Simple Western lane view shows a specifi...
Western Blotting (WB) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Western Blot: MPST Antibody [NBP1-82617] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunofluorescence (IF) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Immunocytochemistry/Immunofluorescence: MPST Antibody [NBP1-82617] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human duodenu...
Western Blotting (WB) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Western Blot: MPST Antibody - Analysis in human cell lines HEK293 and U-251MG. Corre...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Immunohistochemistry-Paraffin: MPST Antibody - Staining of human liver shows strong ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Immunohistochemistry-Paraffin: MPST Antibody - Analysis in human duodenum and lymph ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mercaptopyruvate Sulfurtransferase (MPST) antibody (ABIN4335380) Immunohistochemistry-Paraffin: MPST Antibody - Staining of human lymph node shows we...
Product cited in: Yetik-Anacak, Dikmen, Coletta, Mitidieri, Dereli, Donnarumma, dEmmanuele di Villa Bianca, Sorrentino: "Hydrogen sulfide compensates nitric oxide deficiency in murine corpus cavernosum." in: Pharmacological research, Vol. 113, Issue Pt A, pp. 38-43, 2016 (PubMed). (Sample species: Mouse (Murine)). Further details: Western Blotting

Rashid, Heer, Garle, Alexander, Roberts: "Hydrogen sulphide-induced relaxation of porcine peripheral bronchioles." in: British journal of pharmacology, Vol. 168, Issue 8, pp. 1902-10, 2013 (PubMed).

Shibuya, Mikami, Kimura, Nagahara, Kimura: "Vascular endothelium expresses 3-mercaptopyruvate sulfurtransferase and produces hydrogen sulfide." in: Journal of biochemistry, Vol. 146, Issue 5, pp. 623-6, 2009 (PubMed).

Did you look for something else?