MYT1 antibody (Myelin Transcription Factor 1)

Details for Product anti-MYT1 Antibody No. ABIN4337585, Supplier: Log in to see
Antigen
  • fc56h05
  • myt1
  • si:dkey-202m22.5
  • wu:fc56h05
  • C20orf36
  • MTF1
  • MYTI
  • PLPB1
  • ZC2HC4A
  • Nzf2
  • Nzf2a
  • Nzf2b
  • Nztf2
  • myelin transcription factor 1
  • myelin transcription factor 1a
  • myelin transcription factor 1 S homeolog
  • MYT1
  • myt1a
  • Myt1
  • myt1.S
Alternatives
anti-Human MYT1 antibody for Dot Blot
Reactivity
Human
90
26
23
4
4
3
2
1
1
Host
Rabbit
85
7
Clonality
Polyclonal
Conjugate
This MYT1 antibody is un-conjugated
6
6
6
5
5
5
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
72
52
23
14
9
8
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPLDT
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name Myt1 (MYT1 Antibody Abstract)
Background Gene Symbol: MYT1
Gene ID 4661
Research Area Kinases/Phosphatases, Transcription Factors, Chromatin and Nuclear Signaling
Pathways Cell Division Cycle
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Myelin Transcription Factor 1 (MYT1) antibody (ABIN4337585) Immunohistochemistry: Myt1 Antibody [NBP1-81021] - Staining of human stomach shows st...
Immunofluorescence (IF) image for anti-Myelin Transcription Factor 1 (MYT1) antibody (ABIN4337585) Immunocytochemistry/Immunofluorescence: Myt1 Antibody [NBP1-81021] - ICC-IF analysis ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Myelin Transcription Factor 1 (MYT1) antibody (ABIN4337585) Immunohistochemistry-Paraffin: Myt1 Antibody - Staining of human cerebellum shows mo...
Product cited in: Islam, Smith, Niu, Fang, Iqbal, Sun, Shi, Zhang: "Enhancer Analysis Unveils Genetic Interactions between TLX and SOX2 in Neural Stem Cells and In Vivo Reprogramming." in: Stem cell reports, Vol. 5, Issue 5, pp. 805-15, 2016 (PubMed). (Sample species: Mouse (Murine)). Further details: Immunoprecipitation

Chandrasekar, Dreyer: "The Brain-Specific Neural Zinc Finger Transcription Factor 2b (NZF-2b/7ZFMyt1) Suppresses Cocaine Self-Administration in Rats." in: Frontiers in behavioral neuroscience, Vol. 4, pp. 14, 2010 (PubMed).

Chandrasekar, Dreyer: "The brain-specific Neural Zinc Finger transcription factor 2b (NZF-2b/7ZFMyt1) causes suppression of cocaine-induced locomotor activity." in: Neurobiology of disease, Vol. 37, Issue 1, pp. 86-98, 2009 (PubMed).

Did you look for something else?