NDRG2 antibody (NDRG Family Member 2)

Details for Product anti-NDRG2 Antibody No. ABIN4338340
Antigen
  • NDRG2
  • AI182517
  • AU040374
  • Ndr2
  • SYLD
  • im:6909381
  • si:dkey-88n24.1
  • zgc:101847
  • NDRG family member 2
  • N-myc downstream regulated gene 2
  • NDRG family member 2 S homeolog
  • ndrg2
  • NDRG2
  • Ndrg2
  • ndrg2.S
Reactivity
Human
101
55
55
7
6
6
5
4
4
3
2
1
1
1
Host
Rabbit
84
15
10
Clonality
Polyclonal
Conjugate
This NDRG2 antibody is un-conjugated
5
3
3
3
3
3
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
88
52
25
7
3
2
2
1
1
1
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others NDRG2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name NDRG2 (NDRG2 Antibody Abstract)
Background Gene Symbol: NDRG2
Molecular Weight Theoretical MW: 41 kDa
Gene ID 57447
UniProt Q9UN36
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Western Blot: NDRG2 Antibody [NBP1-81424] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Staining of human saliva...
Immunofluorescence (IF) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Immunocytochemistry/Immunofluorescence: NDRG2 Antibody [NBP1-81424] - Staining of hum...
Western Blotting (WB) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Western Blot: NDRG2 Antibody - Analysis in human liver tissue.
Immunofluorescence (IF) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Immunocytochemistry/Immunofluorescence: NDRG2 Antibody - Immunofluorescent staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Immunohistochemistry-Paraffin: NDRG2 Antibody - Staining in human cerebral cortex an...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Immunohistochemistry-Paraffin: NDRG2 Antibody - Staining of human pancreas shows low...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Immunohistochemistry-Paraffin: NDRG2 Antibody - Staining of human cerebral cortex sh...
Western Blotting (WB) image for anti-NDRG Family Member 2 (NDRG2) antibody (ABIN4338340) Western Blot: NDRG2 Antibody - Staining of human cerebral cortex shows high expression.
Product cited in: Anderson, Russell, Foletta: "NDRG2 promotes myoblast proliferation and caspase 3/7 activities during differentiation, and attenuates hydrogen peroxide - But not palmitate-induced toxicity." in: FEBS open bio, Vol. 5, pp. 668-81, 2015 (PubMed). (Sample species: Mouse (Murine)). Further details: Western Blotting

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Mulder, Björling, Jonasson, Wernérus, Hober, Hökfelt, Uhlén: "Tissue profiling of the mammalian central nervous system using human antibody-based proteomics." in: Molecular & cellular proteomics : MCP, Vol. 8, Issue 7, pp. 1612-22, 2009 (PubMed).

Schilling, Hjelmeland, Radiloff, Liu, Wakeman, Fielhauer, Foster, Lathia, Rich, Wang, Datto: "NDRG4 is required for cell cycle progression and survival in glioblastoma cells." in: The Journal of biological chemistry, Vol. 284, Issue 37, pp. 25160-9, 2009 (PubMed).

Tepel, Roerig, Wolter, Gutmann, Perry, Reifenberger, Riemenschneider: "Frequent promoter hypermethylation and transcriptional downregulation of the NDRG2 gene at 14q11.2 in primary glioblastoma." in: International journal of cancer, Vol. 123, Issue 9, pp. 2080-6, 2008 (PubMed).

Did you look for something else?