Ninein (GSK3B Interacting Protein) (NIN) antibody

Details for Product No. ABIN4339743
Target
Reactivity
Human
10
5
3
Host
Rabbit
12
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
8
7
4
3
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEE VEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLEL EDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Target
Alternative Name Ninein (NIN Antibody Abstract)
Background Gene Symbol: NIN
Gene ID 51199
Pathways Maintenance of Protein Location, SARS-CoV-2 Protein Interactome
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images
Image no. 1 for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining of human pancreas shows lo...
Image no. 2 for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining of human appendix shows hi...
Image no. 3 for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining in human appendix and panc...