Ninein (GSK3B Interacting Protein) (NIN) antibody

Details for Product No. ABIN4339743
Antigen
  • si:ch211-282c13.6
  • ninein
  • 3110068G20Rik
  • AI385615
  • AU024711
  • mKIAA1565
  • SCKL7
  • ninein
  • ninein (GSK3B interacting protein)
  • ninein L homeolog
  • NIN
  • nin
  • nin.L
  • lpg0126
  • LPC_0146
  • lpa_00185
  • Nin
Alternatives
anti-Human Ninein (GSK3B Interacting Protein) antibody for Western Blotting
Reactivity
Human
16
11
8
Host
Rabbit
23
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
19
13
4
4
3
3
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEE VEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLEL EDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name Ninein (NIN Antibody Abstract)
Background Gene Symbol: NIN
Gene ID 51199
Pathways Maintenance of Protein Location
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunocytochemistry/Immunofluorescence: Ninein Antibody [NBP2-13657] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry: Ninein Antibody [NBP2-13657] - Staining of human appendix shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining of human pancreas shows lo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining of human appendix shows hi...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ninein (GSK3B Interacting Protein) (NIN) antibody (ABIN4339743) Immunohistochemistry-Paraffin: Ninein Antibody - Staining in human appendix and panc...
Did you look for something else?