Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) antibody

Details for Product No. ABIN4339781, Supplier: Log in to see
Antigen
  • DRES9
  • Mpt-1
  • Nir-2
  • PITPnm 1
  • Pitpnm
  • R75447
  • Rd9
  • RdgB
  • RdgB1
  • NIR2
  • PITPNM
  • RDGB
  • RDGB1
  • RDGBA
  • RDGBA1
  • phosphatidylinositol transfer protein membrane associated 1
  • phosphatidylinositol transfer protein, membrane-associated 1
  • PITPNM1
  • Pitpnm1
Reactivity
Human
69
45
21
5
5
2
2
2
2
1
1
Host
Rabbit
64
16
2
Clonality
Polyclonal
Conjugate
Un-conjugated
8
8
8
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
54
51
15
13
4
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name NIR2 (PITPNM1 Antibody Abstract)
Background Gene Symbol: PITPNM1
Gene ID 9600
UniProt O00562
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) antibody (ABIN4339781) Immunohistochemistry: NIR2 Antibody [NBP2-34132] - endometrial cancer
Immunofluorescence (IF) image for anti-Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) antibody (ABIN4339781) Immunocytochemistry/Immunofluorescence: NIR2 Antibody [NBP2-34132] - Staining of huma...
Western Blotting (WB) image for anti-Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) antibody (ABIN4339781) Western Blot: NIR2 Antibody [NBP2-34132] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (IHC) image for anti-Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) antibody (ABIN4339781) Immunohistochemistry: NIR2 Antibody [NBP2-34132] - fallopian tube
Immunohistochemistry (IHC) image for anti-Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) antibody (ABIN4339781) Immunohistochemistry: NIR2 Antibody [NBP2-34132] - Immunohistochemical staining of hu...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Phosphatidylinositol Transfer Protein, Membrane-Associated 1 (PITPNM1) antibody (ABIN4339781) Immunohistochemistry-Paraffin: NIR2 Antibody - Staining of human fallopian tube show...
Did you look for something else?