NOL12 antibody (Nucleolar Protein 12)

Details for Product anti-NOL12 Antibody No. ABIN4340310, Supplier: Log in to see
Antigen
  • nop25
  • MGC88868
  • Nop25
  • dJ37E16.7
  • C78541
  • RGD1305327
  • zgc:56457
  • MGC154824
  • nucleolar protein 12
  • nucleolar protein 12 S homeolog
  • NOL12
  • nol12
  • Nol12
  • nol12.S
Reactivity
Human
16
8
7
1
1
1
1
1
1
Host
Rabbit
16
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
14
7
5
4
3
3
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKAR
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others NOL12 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name NOL12 (NOL12 Antibody Abstract)
Background Gene Symbol: NOL12
Gene ID 79159
UniProt Q9UGY1
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Nucleolar Protein 12 (NOL12) antibody (ABIN4340310) Immunocytochemistry/Immunofluorescence: NOL12 Antibody [NBP1-86155] - Analysis of hum...
Immunohistochemistry (IHC) image for anti-Nucleolar Protein 12 (NOL12) antibody (ABIN4340310) Immunohistochemistry: NOL12 Antibody [NBP1-86155] - Immunohistochemical staining of h...
Did you look for something else?