Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL) antibody Primary Antibody

NSDHL Reactivity: Human ICC, IF, IHC, IHC (p), WB Host: Rabbit Polyclonal unconjugated
Pubmed (2)
Catalog No. ABIN4340743
Contact our Customer Service for availability and price in your country.
  • Target
    Reactivity
    Human
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    Un-conjugated
    Application
    Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Specificity
    Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
    Purification
    Immunogen affinity purified
    Immunogen
    This antibody was developed against Recombinant Protein corresponding to amino acids:MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPSSNNKELFYRVNYIGT
    Isotype
    IgG
  • Application Notes
    Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
    Comment

    The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    PBS ( pH 7.2) and 40 % Glycerol
    Buffer contains: 0.02 % Sodium Azide
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
  • Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

    Parent, Winstall, Beauchemin, Paquet, Poirier, Bertrand: "Proteomic analysis of enriched lysosomes at early phase of camptothecin-induced apoptosis in human U-937 cells." in: Journal of proteomics, Vol. 72, Issue 6, pp. 960-73, 2009 (PubMed).

  • Target
    Alternative Name
    NSDHL (NSDHL Antibody Abstract)
    Synonyms
    zgc:112474, H105E3, SDR31E1, XAP104, AI747449, Bpa, Str, NAD(P) dependent steroid dehydrogenase-like, NAD(P) dependent steroid dehydrogenase-like L homeolog, NSDHL, nsdhl, nsdhl.L, Nsdhl
    Background
    Gene Symbol: NSDHL
    Gene ID
    50814
You are here: