NUDCD3 antibody (NudC Domain Containing 3)

Details for Product anti-NUDCD3 Antibody No. ABIN4341091
Antigen
  • NudCL
  • AI427847
  • BC024322
  • RP23-28G13.2
  • mKIAA1068
  • NudC domain containing 3
  • Nudcd3
  • NUDCD3
Reactivity
Human
21
5
4
2
2
2
2
2
1
1
1
1
1
Host
Rabbit
19
2
Clonality
Polyclonal
Conjugate
This NUDCD3 antibody is un-conjugated
3
2
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
13
6
2
1
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGAAE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others NUDCD3 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name NUDCD3 (NUDCD3 Antibody Abstract)
Background Gene Symbol: NUDCD3
Gene ID 23386
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-NudC Domain Containing 3 (NUDCD3) antibody (ABIN4341091) Immunocytochemistry/Immunofluorescence: NUDCD3 Antibody [NBP1-82939] - Staining of hu...
Image no. 2 for anti-NudC Domain Containing 3 (NUDCD3) antibody (ABIN4341091) Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human rectu...
Image no. 3 for anti-NudC Domain Containing 3 (NUDCD3) antibody (ABIN4341091) Western Blot: NUDCD3 Antibody [NBP1-82939] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...
Product cited in: Asante, Stevenson, Stephens: "Subunit composition of the human cytoplasmic dynein-2 complex." in: Journal of cell science, 2014 (PubMed). (Sample species: Human). Further details: Immunoprecipitation

Did you look for something else?