PIGR antibody (Polymeric Immunoglobulin Receptor)

Details for Product anti-PIGR Antibody No. ABIN4345568, Supplier: Log in to see
Antigen
  • DKFZp469G1013
  • RNPIGR2
  • pIgA-R
  • polymeric immunoglobulin receptor
  • PIGR
  • Pigr
Reactivity
Human
73
28
23
16
3
2
2
1
1
Host
Rabbit
126
7
2
Clonality
Polyclonal
Conjugate
This PIGR antibody is un-conjugated
19
16
6
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
106
80
46
21
18
12
11
6
2
2
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name pIgR (PIGR Antibody Abstract)
Background Gene Symbol: PIGR
Gene ID 5284
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Polymeric Immunoglobulin Receptor (PIGR) antibody (ABIN4345568) Western Blot: PIGR Antibody [NBP1-86095] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Polymeric Immunoglobulin Receptor (PIGR) antibody (ABIN4345568) Immunohistochemistry-Paraffin: PIGR Antibody [NBP1-86095] - Staining of human colon s...
Western Blotting (WB) image for anti-Polymeric Immunoglobulin Receptor (PIGR) antibody (ABIN4345568) Western Blot: pIgR Antibody - Analysis in human colon tissue.
Product cited in: Berntsson, Lundgren, Nodin, Uhlén, Gaber, Jirström: "Expression and prognostic significance of the polymeric immunoglobulin receptor in epithelial ovarian cancer." in: Journal of ovarian research, Vol. 7, pp. 26, 2014 (PubMed).

Fristedt, Gaber, Hedner, Nodin, Uhlén, Eberhard, Jirström: "Expression and prognostic significance of the polymeric immunoglobulin receptor in esophageal and gastric adenocarcinoma." in: Journal of translational medicine, Vol. 12, pp. 83, 2014 (PubMed).

Fristedt, Elebro, Gaber, Jonsson, Heby, Yudina, Nodin, Uhlén, Eberhard, Jirström: "Reduced expression of the polymeric immunoglobulin receptor in pancreatic and periampullary adenocarcinoma signifies tumour progression and poor prognosis." in: PLoS ONE, Vol. 9, Issue 11, pp. e112728, 2014 (PubMed). (Sample species: Human). Further details: Immunohistochemistry

Trevisi, Gandolfi, Priori, Messori, Colombo, Mazzoni, Lallès, Bosi: "Age-related expression of the polymeric immunoglobulin receptor (pIgR) in the gastric mucosa of young pigs." in: PLoS ONE, Vol. 8, Issue 11, pp. e81473, 2013 (PubMed). Further details: Immunohistochemistry

Did you look for something else?