PRDM4 antibody (PR Domain Containing 4)

Details for Product anti-PRDM4 Antibody No. ABIN4347211, Supplier: Log in to see
Antigen
  • prdm4
  • MGC53711
  • MGC132367
  • PRDM4
  • pfm1
  • MGC145200
  • si:dkey-180p18.8
  • PFM1
  • 1700031E19Rik
  • 2810470D21Rik
  • AW552272
  • SC-1
  • PR/SET domain 4
  • PR domain 4 L homeolog
  • PR domain 4
  • PR domain containing 4
  • PRDM4
  • prdm4.L
  • prdm4
  • Prdm4
Alternatives
anti-Human PRDM4 antibody for ELISA
Reactivity
Human
51
17
9
4
3
3
2
2
2
1
1
1
1
1
Host
Rabbit
18
17
16
Clonality
Polyclonal
Conjugate
This PRDM4 antibody is un-conjugated
4
2
2
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
39
37
9
8
5
4
3
3
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LSTSHNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVSPSLQMEDSNSNKENMATLFTIWCTLCDRAYPSDCPEHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGAEVGVWTGETIPVRTCFGPLIG
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others PRDM4 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name PRDM4 (PRDM4 Antibody Abstract)
Background Gene Symbol: PRDM4
Gene ID 11108
Pathways Neurotrophin Signaling Pathway
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-PR Domain Containing 4 (PRDM4) antibody (ABIN4347211) Immunocytochemistry/Immunofluorescence: PRDM4 Antibody [NBP1-80921] - staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PR Domain Containing 4 (PRDM4) antibody (ABIN4347211) Immunohistochemistry-Paraffin: PRDM4 Antibody [NBP1-80921] - Staining of human gall b...
Immunofluorescence (IF) image for anti-PR Domain Containing 4 (PRDM4) antibody (ABIN4347211) Immunocytochemistry/Immunofluorescence: PRDM4 Antibody - Staining of human pancreas ...
Product cited in: Bogani, Morgan, Nelson, Costello, McGouran, Kessler, Robertson, Bikoff: "The PR/SET domain zinc finger protein Prdm4 regulates gene expression in embryonic stem cells but plays a nonessential role in the developing mouse embryo." in: Molecular and cellular biology, Vol. 33, Issue 19, pp. 3936-50, 2013 (PubMed).

Did you look for something else?