RORA antibody (RAR-Related Orphan Receptor A) (N-Term)

Details for Product anti-RORA Antibody No. ABIN4350938
Antigen
  • ror1
  • ror2
  • ror3
  • rzra
  • nr1f1
  • MGC146531
  • NR1F1
  • ROR1
  • ROR2
  • ROR3
  • RZR-ALPHA
  • RZRA
  • RORalpha-B
  • gb:dq017624
  • rora2
  • 9530021D13Rik
  • Nr1f1
  • nmf267
  • sg
  • staggerer
  • tmgc26
  • RORalpha1
  • RAR related orphan receptor A
  • RAR-related orphan receptor A
  • RAR-related orphan receptor A, paralog a
  • RAR-related orphan receptor alpha
  • RORA
  • rora
  • Rora
  • roraa
Alternatives
anti-Human RORA antibody for Immunohistochemistry (Paraffin-embedded Sections)
Epitope
N-Term
18
16
12
7
4
4
3
3
3
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
142
54
44
20
18
13
12
11
10
8
7
7
6
6
4
2
1
1
1
1
Host
Rabbit
134
8
Clonality
Polyclonal
Conjugate
This RORA antibody is un-conjugated
6
5
4
2
2
2
2
2
2
2
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
105
47
32
25
19
10
5
2
1
1
1
Options
Immunogen Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC.
Purification Protein A purified
Plasmids, Primers & others Plasmids, Primers & others RORA products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name ROR alpha/nr1f1 (RORA Antibody Abstract)
Background Gene Symbol: RORA
Molecular Weight Theoretical MW: 63 kDa
Gene ID 6095
UniProt P35398
Pathways Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
Application Notes Western Blot 1.25 μg/mL, Immunocytochemistry/Immunofluorescence 1:10-1:2000This is a rabbit polyclonal antibody against RORA and was validated on Western blot and is useful in Immunofluorescence (PMID: 21480365). The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-RAR-Related Orphan Receptor A (RORA) (N-Term) antibody (ABIN4350938) Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentratio...
Product cited in: Suyama, Silagi, Choi, Sakabe, Mochida, Shapiro, Risbud: "Circadian factors BMAL1 and RORα control HIF-1α transcriptional activity in nucleus pulposus cells: implications in maintenance of intervertebral disc health." in: Oncotarget, Vol. 7, Issue 17, pp. 23056-71, 2016 (PubMed). Method employed by authors: Western Blotting (WB)

Benderdour, Fahmi, Beaudet, Fernandes, Shi: "Nuclear receptor retinoid-related orphan receptor α1 modulates the metabolic activity of human osteoblasts." in: Journal of cellular biochemistry, Vol. 112, Issue 8, pp. 2160-9, 2011 (PubMed).

Did you look for something else?