Scinderin (SCIN) antibody

Details for Product No. ABIN4352226
Antigen
  • MGC81993
  • si:ch211-134n17.3
  • AW545522
  • adseverin
  • Scind
  • scinderin L homeolog
  • scinderin
  • adseverin
  • scin.L
  • SCIN
  • scin
  • LOC100496020
  • Scin
Reactivity
Human
17
4
3
Host
Rabbit
15
2
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
14
8
4
4
3
2
1
Options
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHG
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name SCIN (SCIN Antibody Abstract)
Background Gene Symbol: SCIN
Gene ID 85477
Pathways Regulation of Actin Filament Polymerization
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Scinderin (SCIN) antibody (ABIN4352226) Western Blot: SCIN Antibody [NBP1-89230] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Image no. 2 for anti-Scinderin (SCIN) antibody (ABIN4352226) Immunohistochemistry-Paraffin: SCIN Antibody [NBP1-89230] - Staining of human kidney ...
Image no. 3 for anti-Scinderin (SCIN) antibody (ABIN4352226) Western Blot: SCIN Antibody [NBP1-89230] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Image no. 4 for anti-Scinderin (SCIN) antibody (ABIN4352226) Immunocytochemistry/Immunofluorescence: SCIN Antibody [NBP1-89230] - Staining of huma...
Did you look for something else?