Signal-Induced Proliferation-Associated 1 Like 1 (SIPA1L1) antibody

Details for Product No. ABIN4353830, Supplier: Log in to see
Antigen
  • 4931426N11Rik
  • AW213287
  • Spar
  • mKIAA0440
  • SPAL
  • Spa-1
  • Spa1
  • E6TP1
  • cb600
  • id:ibd5092
  • sb:cb600
  • si:ch211-106p8.1
  • wu:fc43g06
  • signal induced proliferation associated 1 like 1
  • signal-induced proliferation-associated 1 like 1
  • SIPA1L1
  • sipa1l1
  • Sipa1l1
Reactivity
Human
14
9
6
Host
Rabbit
14
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
13
10
8
6
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IRQRSNSDITISELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTPTKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLRNAKGEELGKSSDLEDNRSE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigen
Alternative Name SIPA1L1 (SIPA1L1 Antibody Abstract)
Background Gene Symbol: SIPA1L1
Gene ID 26037
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Signal-Induced Proliferation-Associated 1 Like 1 (SIPA1L1) antibody (ABIN4353830) Immunocytochemistry/Immunofluorescence: SIPA1L1 Antibody [NBP1-90482] - Staining of h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Signal-Induced Proliferation-Associated 1 Like 1 (SIPA1L1) antibody (ABIN4353830) Immunohistochemistry-Paraffin: SIPA1L1 Antibody [NBP1-90482] - Staining of human kidn...
Immunofluorescence (IF) image for anti-Signal-Induced Proliferation-Associated 1 Like 1 (SIPA1L1) antibody (ABIN4353830) Immunocytochemistry/Immunofluorescence: SIPA1L1 Antibody - Immunofluorescent stainin...
Did you look for something else?