SNRK antibody (SNF Related Kinase)

Details for Product anti-SNRK Antibody No. ABIN4354936, Supplier: Log in to see
Antigen
  • HSNFRK
  • 2010012F07Rik
  • AI448042
  • AW547029
  • E030034B15
  • R74830
  • mKIAA0096
  • SNF related kinase
  • SNRK
  • Snrk
Reactivity
Human, Mouse (Murine), Rat (Rattus)
33
20
3
2
2
2
1
1
1
1
Host
Rabbit
48
3
Clonality
Polyclonal
Conjugate
This SNRK antibody is un-conjugated
4
4
4
4
4
4
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
49
28
19
7
5
4
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VPQDLEDDLTATPLSHATVPQSPARAADSVLNGHRSKGLCDSAKKDDLPELAGPALSTVPPASLKPTASGRKCLFRVEEDEEEDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIFEEGESDDEFDMDENLPPKLSRLKM
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name SNRK (SNRK Antibody Abstract)
Background Gene Symbol: SNRK
Gene ID 54861
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-SNF Related Kinase (SNRK) antibody (ABIN4354936) Western Blot: SNRK Antibody [NBP1-83668] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SNF Related Kinase (SNRK) antibody (ABIN4354936) Immunohistochemistry-Paraffin: SNRK Antibody [NBP1-83668] - Staining of human testis ...
Immunofluorescence (IF) image for anti-SNF Related Kinase (SNRK) antibody (ABIN4354936) Immunocytochemistry/Immunofluorescence: SNRK Antibody [NBP1-83668] - Staining of huma...
Immunofluorescence (IF) image for anti-SNF Related Kinase (SNRK) antibody (ABIN4354936) Immunocytochemistry/Immunofluorescence: SNRK Antibody - Staining of human cell line ...
Western Blotting (WB) image for anti-SNF Related Kinase (SNRK) antibody (ABIN4354936) Western Blot: SNRK Antibody - Analysis in human cell lines PC-3 and MCF-7 using Anti...
Did you look for something else?