SSH2 antibody (Slingshot Homolog 2 (Drosophila))

Details for Product anti-SSH2 Antibody No. ABIN4356070, Supplier: Log in to see
Antigen
  • BB104748
  • BC030940
  • SSH-2
  • mSSH-2L
  • SSH-2L
  • ssh2
  • zgc:175142
  • slingshot homolog 2 (Drosophila)
  • slingshot protein phosphatase 2
  • slingshot protein phosphatase 2 L homeolog
  • slingshot protein phosphatase 2b
  • Ssh2
  • SSH2
  • ssh2.L
  • ssh2b
Reactivity
Human
17
4
4
Host
Rabbit
11
6
Clonality
Polyclonal
Application
Immunohistochemistry (IHC)
12
5
4
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:RVEIIEYTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPE
Isotype IgG
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others SSH2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name SSH2 (SSH2 Antibody Abstract)
Background Gene Symbol: SSH2
Gene ID 85464
Application Notes Immunohistochemistry 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (IHC) image for anti-Slingshot Homolog 2 (Drosophila) (SSH2) antibody (ABIN4356070) Immunohistochemistry: SSH2 Antibody [NBP2-49245] - Staining of human duodenum shows l...
Did you look for something else?