TRAPPC6A antibody (Trafficking Protein Particle Complex 6A)

Details for Product anti-TRAPPC6A Antibody No. ABIN4362197, Supplier: Log in to see
Antigen
  • TRS33
  • 1810073E21Rik
  • 4930519D19Rik
  • AI480686
  • mhyp
  • trafficking protein particle complex 6A
  • TRAPPC6A
  • Trappc6a
Reactivity
Human
23
Host
Rabbit
23
Clonality
Polyclonal
Conjugate
This TRAPPC6A antibody is un-conjugated
2
2
2
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
18
14
11
8
6
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLR
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others TRAPPC6A products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name TRAPPC6A (TRAPPC6A Antibody Abstract)
Background Gene Symbol: TRAPPC6A
Gene ID 79090
UniProt O75865
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Trafficking Protein Particle Complex 6A (TRAPPC6A) antibody (ABIN4362197) Immunohistochemistry-Paraffin: TRAPPC6A Antibody - Staining of human pancreas shows ...
Did you look for something else?