TRIM5 antibody (Tripartite Motif Containing 5)

Details for Product anti-TRIM5 Antibody No. ABIN4362497, Supplier: Log in to see
  • TRIM5
  • RNF88
  • TRIM5alpha
  • EG667823
  • Gm8833
  • RGD1304579
  • tripartite motif containing 5
  • tripartite motif-containing 5
  • TRIM5
  • Trim5
anti-Human TRIM5 antibody for ELISA
This TRIM5 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLREL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others TRIM5 products on genomics-online (e.g. as negative or positive controls)
Alternative Name TRIM5 (TRIM5 Antibody Abstract)
Background Gene Symbol: TRIM5
Gene ID 85363
Pathways Activation of Innate immune Response
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Tripartite Motif Containing 5 (TRIM5) antibody (ABIN4362497) Immunohistochemistry-Paraffin: TRIM5 Antibody - Staining of human pancreas shows dis...
Product cited in: Sandler, Bosinger, Estes, Zhu, Tharp, Boritz, Levin, Wijeyesinghe, Makamdop, del Prete, Hill, Timmer, Reiss, Yarden, Darko, Contijoch, Todd, Silvestri, Nason, Norgren, Keele, Rao, Langer, Lifson et al.: "Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. ..." in: Nature, Vol. 511, Issue 7511, pp. 601-5, 2014 (PubMed).

Did you look for something else?