RSPH1 antibody (Radial Spoke Head 1 Homolog (Chlamydomonas))

Details for Product anti-RSPH1 Antibody No. ABIN4363101, Supplier: Log in to see
  • TSGA2
  • RSP44
  • RSPH10A
  • TSA2
  • MCA
  • Tsga2
  • radial spoke head 1 homolog
  • radial spoke head 1 homolog (Chlamydomonas)
  • RSPH1
  • Rsph1
This RSPH1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others RSPH1 products on genomics-online (e.g. as negative or positive controls)
Alternative Name TSGA2 (RSPH1 Antibody Abstract)
Background Gene Symbol: RSPH1
Gene ID 89765
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Radial Spoke Head 1 Homolog (Chlamydomonas) (RSPH1) antibody (ABIN4363101) Immunohistochemistry-Paraffin: TSGA2 Antibody - Staining of human testis shows cytop...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Radial Spoke Head 1 Homolog (Chlamydomonas) (RSPH1) antibody (ABIN4363101) Immunohistochemistry-Paraffin: TSGA2 Antibody - Staining of human placenta shows low...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Radial Spoke Head 1 Homolog (Chlamydomonas) (RSPH1) antibody (ABIN4363101) Immunohistochemistry-Paraffin: TSGA2 Antibody - Staining in human fallopian tube and...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Radial Spoke Head 1 Homolog (Chlamydomonas) (RSPH1) antibody (ABIN4363101) Immunohistochemistry-Paraffin: TSGA2 Antibody - Staining of human fallopian tube sho...
Product cited in: Onoufriadis, Shoemark, Schmidts, Patel, Jimenez, Liu, Thomas, Dixon, Hirst, Rutman, Burgoyne, Williams, Scully, Bolard, Lafitte, Beales, Hogg, Yang, Chung, Emes, OCallaghan, Bouvagnet, Mitchison: "Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects." in: Human molecular genetics, Vol. 23, Issue 13, pp. 3362-74, 2014 (PubMed).

Kott, Legendre, Copin, Papon, Dastot-Le Moal, Montantin, Duquesnoy, Piterboth, Amram, Bassinet, Beucher, Beydon, Deneuville, Houdouin, Journel, Just, Nathan, Tamalet, Collot, Jeanson, Le Gouez et al.: "Loss-of-function mutations in RSPH1 cause primary ciliary dyskinesia with central-complex and radial-spoke defects. ..." in: American journal of human genetics, Vol. 93, Issue 3, pp. 561-70, 2013 (PubMed).

Did you look for something else?