Zinc Finger Protein 443 (ZNF443) antibody

Details for Product No. ABIN4367264, Supplier: Log in to see
Antigen
  • ZK1
  • zinc finger protein 443
  • ZNF443
Reactivity
Human
24
Host
Rabbit
24
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
21
17
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VALEDVAVNFTREEWALLGPCQKNLYKDVMQETIRNLDCVVMKWKDQNIEDQYRYPRKNLRCRMLERFVESKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMRGEKVMGHSSLNCYIRVGA
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Alternative Name ZNF443 (ZNF443 Antibody Abstract)
Background Gene Symbol: ZNF443
Gene ID 10224
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Zinc Finger Protein 443 (ZNF443) antibody (ABIN4367264) Immunohistochemistry-Paraffin: ZNF443 Antibody - Staining of human testis shows stro...
Did you look for something else?