AGO4 antibody (N-Term)

Catalog No. ABIN4886439

Product Details anti-AGO4 Antibody

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Binding Specificity: AA 114-153, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGO4 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human,Rat.

Sequence: KDQTFKVSVQ WVSVVSLQLL LEALAGHLNE VPDDSVQALD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human,Rat.
Gene Name: argonaute 4, RISC catalytic component
Protein Name: Protein argonaute-4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for AGO4

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Alternative Name: AGO4 (EIF2C4 Products)

Synonyms: EIF2C4 antibody, ago4 antibody, Argonaute4 antibody, argonaute-4 antibody, eif2c4 antibody, wu:fd14f04 antibody, ARGONAUTE 4 antibody, OCP11 antibody, OVEREXPRESSOR OF CATIONIC PEROXIDASE 11 antibody, T20P8.9 antibody, T20P8_9 antibody, Eif2c4 antibody, 5730550L01Rik antibody, AI481660 antibody, argonaute 4, RISC catalytic component antibody, argonaute 1, RISC catalytic component antibody, argonaute RISC catalytic component 4 antibody, Argonaute family protein antibody, argonaute 4, RISC catalytic component L homeolog antibody, argonaute RISC catalytic subunit 4 antibody, AGO4 antibody, ago1 antibody, ago4 antibody, Ago4 antibody, ago4.L antibody

Background: AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.

Synonyms: Ago 4 | Ago4 | Argonaute4 |Argonaute 4 | Argonaute-4 | EIF 2C 4 | eIF-2C 4 | eIF2C 4 | eif2c4 | hAgo4 | KIAA1567 | Protein argonaute-4 | Q9HCK5

Gene ID: 192670

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Cellular Glucan Metabolic Process