PSMA1 antibody (C-Term)

Catalog No. ABIN4886704

Product Details anti-PSMA1 Antibody

Target: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Binding Specificity: AA 159-204, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-1(PSMA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: MSIGARSQSA RTYLERHMSE FMECNLNELV KHGLRALRET LP

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-1(PSMA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 1
Protein Name: Proteasome subunit alpha type-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PSMA1 (159-204aa MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PSMA1

Target: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Alternative Name: PSMA1 (PSMA1 Products)

Synonyms: PSMA1 antibody, pros30 antibody, DDBDRAFT_0204226 antibody, DDBDRAFT_0214956 antibody, DDB_0204226 antibody, DDB_0214956 antibody, C2 antibody, HC2 antibody, Pros-30 antibody, alpha-type antibody, NU antibody, PROS30 antibody, CC2 antibody, zgc:92726 antibody, 143314_at antibody, Alpha-6 antibody, CG4904 antibody, Dmel\CG4904 antibody, PROS-35 antibody, PROS-Dm35 antibody, Pros-35 antibody, Pros-Dm35 antibody, Prosalpha6 antibody, alpha6 antibody, alpha_dm antibody, anon-SAGE:Wang-116 antibody, pros 35 antibody, pros35 antibody, proteasome subunit alpha 1 antibody, proteasome subunit alpha type 1 antibody, 20S proteasome subunit C2 antibody, proteasome (prosome, macropain) subunit, alpha type 1 antibody, proteasome subunit alpha 1 L homeolog antibody, Proteasome alpha6 subunit antibody, PSMA1 antibody, psma1 antibody, CNB05540 antibody, psmA1 antibody, Psma1 antibody, psma1.L antibody, Prosalpha6 antibody

Background: Proteasome subunit alpha type-1 is a protein that in humans is encoded by the PSMA1 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Synonyms: HC 2 | HC2 | PROS30 | PROS-30 | PROS 30 | PSC 2 | PSC2 | PSMA 1 | PSMA1 | P25786

Gene ID: 5682

UniProt: P25786

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA