PSMA2 antibody (Middle Region)

Catalog No. ABIN4886705

Product Details anti-PSMA2 Antibody

Target: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Binding Specificity: AA 82-123, Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.

Sequence: DYRVLVHRAR KLAQQYYLVY QEPIPTAQLV QRVASVMQEY T

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.
Gene Name: proteasome subunit alpha 2
Protein Name: Proteasome subunit alpha type-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PSMA2

Target: PSMA2 (Proteasome Subunit alpha 2 (PSMA2))

Alternative Name: PSMA2 (PSMA2 Products)

Synonyms: Lmpc3 antibody, wu:faa49c06 antibody, wu:fb98h03 antibody, zgc:110710 antibody, HC3 antibody, MU antibody, PMSA2 antibody, PSC2 antibody, proteasome (prosome, macropain) subunit, alpha type 2 antibody, proteasome subunit alpha 2 antibody, proteasome subunit alpha 2 L homeolog antibody, Psma2 antibody, psma2 antibody, psma2.L antibody, PSMA2 antibody

Background: Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.

Synonyms: HC3 | MU | PMSA2 | PSC2 | PSC3 | PSMA 2 | PSMA2 | P25787

Gene ID: 5683

UniProt: P25787

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA