HNF4 gamma antibody (Hepatocyte Nuclear Factor 4 gamma) (C-Term)

Details for Product anti-HNF4G Antibody No. ABIN4889989, Supplier: Log in to see
  • HNF4G
  • hnf4gamma
  • zgc:153265
  • NR2A2
  • NR2A3
  • hepatocyte nuclear factor 4 gamma
  • hepatocyte nuclear factor 4, gamma
  • HNF4G
  • hnf4g
  • Hnf4g
anti-Humain HNF4 gamma antibody pour Immunohistochemistry (Paraffin-embedded Sections)
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to HNF4G(hepatocyte nuclear factor 4, gamma) The peptide sequence was selected from the C terminal of HNF4G (NP_004124). Peptide sequence QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others HNF4 gamma products on genomics-online (e.g. as negative or positive controls)
Alternative Name HNF-4 gamma/nr2a2 (HNF4G Antibody Abstract)
Background Gene Symbol: HNF4G
Molecular Weight Theoretical MW: 46 kDa
Gene ID 3174
UniProt Q14541
Pathways Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
Application Notes Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against HNF4G and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Hepatocyte Nuclear Factor 4 gamma (HNF4G) (C-Term) antibody (ABIN4889989) Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52810] - MCF-7 whole cell lysates, con...
Western Blotting (WB) image for anti-Hepatocyte Nuclear Factor 4 gamma (HNF4G) (C-Term) antibody (ABIN4889989) Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52810] - Human Adult Placenta Antibody...
Did you look for something else?