NR0B2 antibody (Nuclear Receptor Subfamily 0, Group B, Member 2)

Details for Product anti-NR0B2 Antibody No. ABIN4889993, Supplier: Log in to see
  • SHP
  • SHP1
  • SHP-1
  • Shp1
  • Shp
  • NR0B2-A
  • Nr0b2
  • SHP-A
  • gb:bc058069
  • nuclear receptor subfamily 0 group B member 2
  • nuclear receptor subfamily 0, group B, member 2
  • nuclear receptor subfamily 0, group B, member 2a
  • NR0B2
  • Nr0b2
  • nr0b2a
anti-Humain NR0B2 antibody pour Immunohistochemistry (Paraffin-embedded Sections)
This NR0B2 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to NR0B2(nuclear receptor subfamily 0, group B, member 2) The peptide sequence was selected from the middle region of NR0B2. Peptide sequence AEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSL.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others NR0B2 products on genomics-online (e.g. as negative or positive controls)
Alternative Name SHP/NR0B2/Nuclear Receptor SHP (NR0B2 Antibody Abstract)
Background Gene Symbol: NR0B2
Gene ID 8431
UniProt Q15466
Pathways Nuclear Receptor Transcription Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against NR0B2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2) antibody (ABIN4889993) Western Blot: SHP/NR0B2/Nuclear Receptor SHP Antibody [NBP1-52817] - Transfected 293T...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2) antibody (ABIN4889993) Immunohistochemistry-Paraffin: SHP/NR0B2/Nuclear Receptor SHP Antibody [NBP1-52817] -...
Did you look for something else?