HBS1-Like (S. Cerevisiae) (HBS1L) (C-Term) antibody

Details for Product No. ABIN4889998, Supplier: Log in to see
  • EF-1a
  • ERFS
  • HBS1
  • HSPC276
  • 2810035F15Rik
  • AI326327
  • eRFS
  • wu:fc23c07
  • zgc:55400
  • Hbs1l
  • HBS1 like translational GTPase
  • Hbs1-like (S. cerevisiae)
  • HBS1-like translational GTPase
  • elongation factor 1 alpha like protein
  • HBS1-like (S. cerevisiae)
  • HBS1 like translational GTPase L homeolog
  • HBS1-like protein
  • HBS1L
  • Hbs1l
  • hbs1l
  • SJAG_02601
  • hbs1l.L
  • LOC101787962
Immunofluorescence (IF), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to HBS1L(HBS1-like (S. cerevisiae)) The peptide sequence was selected from the C terminal of HBS1L. Peptide sequence MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH.
Purification Immunogen affinity purified
Alternative Name HBS1L (HBS1L Antibody Abstract)
Background Gene Symbol: HBS1L
Molecular Weight Theoretical MW: 22 kDa
Gene ID 10767
UniProt Q9Y450
Application Notes Western Blot 1:100-1:2000, ImmunofluorescenceThis is a rabbit polyclonal antibody against HBS1L and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-HBS1-Like (S. Cerevisiae) (HBS1L) (C-Term) antibody (ABIN4889998) Immunofluorescence: HBS1L Antibody [NBP1-52835] - Formalin Fixed Paraffin Embedded Ti...
Western Blotting (WB) image for anti-HBS1-Like (S. Cerevisiae) (HBS1L) (C-Term) antibody (ABIN4889998) Western Blot: HBS1L Antibody [NBP1-52835] - MCF-7 whole cell lysates, concentration 0...
Did you look for something else?