PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) antibody

Details for Product No. ABIN4890003
  • 6530411D08Rik
  • Pwp2h
  • wdp103
  • EHOC-17
  • PWP2H
  • UTP1
  • cb471
  • zgc:56063
  • PWP2 periodic tryptophan protein homolog (yeast)
  • PWP2, small subunit processome component
  • Pwp2
  • PWP2
  • pwp2h
Western Blotting (WB)
Immunogen Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM.
Purification Immunogen affinity purified
Alternative Name PWP2H
Background Gene Symbol: PWP2
Gene ID 5822
UniProt Q15269
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PWP2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) antibody (ABIN4890003) Western Blot: PWP2H Antibody [NBP1-52844] - Analysis of 721_B cell lysate. Antibody D...
Western Blotting (WB) image for anti-PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) antibody (ABIN4890003) Western Blot: PWP2H Antibody [NBP1-52844] - Reccomended Titration: 0.2 - 1 ug/ml ELIS...
Western Blotting (WB) image for anti-PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) antibody (ABIN4890003) Western Blot: PWP2H Antibody [NBP1-52844] - Sample Type: MCF7 Antibody Dilution: 1.0 ...
Did you look for something else?