Cystathionase (N-Term) antibody

Details for Product No. ABIN4890006, Supplier: Log in to see
Antigen
Epitope
N-Term
6
2
1
Reactivity
Human
16
4
3
1
1
Host
Rabbit
15
1
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
Application
Immunoprecipitation (IP), Western Blotting (WB)
9
8
6
6
4
4
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to CTH(cystathionase (cystathionine gamma-lyase)) The peptide sequence was selected from the N terminal of human CTH. Peptide sequence VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF.
Purification Immunogen affinity purified
Antigen
Background Gene Symbol: CTH
Molecular Weight Theoretical MW: 44 kDa
Gene ID 1491
UniProt P32929
Application Notes Western Blot 0.2-1 μg/mL, ImmunoprecipitationThis is a rabbit polyclonal antibody against CTH and was validated on Western blot. Use in Immunoprecipitation reported in scientific literature (PMID 25900831) The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Cystathionase (N-Term) antibody (ABIN4890006) Western Blot: Cystathionase Antibody [NBP1-52849] - Transfected 293T cell lysate, con...
Western Blotting (WB) image for anti-Cystathionase (N-Term) antibody (ABIN4890006) Western Blot: Cystathionase Antibody [NBP1-52849] - CSE expression in wild type HEK29...
Product cited in: Yuan, Peng, Khan, Nanduri, Singh, Vasavda, Semenza, Kumar, Snyder, Prabhakar: "H2S production by reactive oxygen species in the carotid body triggers hypertension in a rodent model of sleep apnea." in: Science signaling, Vol. 9, Issue 441, pp. ra80, 2016 (PubMed). Method employed by authors: Western Blotting (WB) (Sample species: Rat (Rattus)).

Yuan, Vasavda, Peng, Makarenko, Raghuraman, Nanduri, Gadalla, Semenza, Kumar, Snyder, Prabhakar: "Protein kinase G-regulated production of H2S governs oxygen sensing." in: Science signaling, Vol. 8, Issue 373, pp. ra37, 2015 (PubMed). Further details: Western Blotting,Immunoprecipitation

Madden, Ahlf, Dantuma, Olson, Roerig: "Precursors and inhibitors of hydrogen sulfide synthesis affect acute hypoxic pulmonary vasoconstriction in the intact lung." in: Journal of applied physiology (Bethesda, Md. : 1985), Vol. 112, Issue 3, pp. 411-8, 2012 (PubMed).

Did you look for something else?