Interferon Related Developmental Regulator 1 (IFRD1) (N-Term) antibody

Details for Product No. ABIN4890007, Supplier: Log in to see
  • im:7067566
  • si:dkey-192l17.2
  • wu:fi35f04
  • wu:fj67a06
  • zgc:154080
  • IFR1
  • PC4
  • TIS7
  • Ifnl
  • Tis7
  • Pc4
  • interferon-related developmental regulator 1
  • interferon related developmental regulator 1 L homeolog
  • interferon related developmental regulator 1
  • ifrd1
  • ifrd1.L
  • IFRD1
  • Ifrd1
Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to IFRD1(interferon-related developmental regulator 1) The peptide sequence was selected from the N terminal of IFRD1. Peptide sequence VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL.
Purification Immunogen affinity purified
Alternative Name IFRD1 (IFRD1 Antibody Abstract)
Background Gene Symbol: IFRD1
Molecular Weight Theoretical MW: 50 kDa
Gene ID 3475
UniProt O00458
Application Notes Western Blot 1:100-1:2000, ImmunohistochemistryThis is a rabbit polyclonal antibody against IFRD1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Interferon Related Developmental Regulator 1 (IFRD1) (N-Term) antibody (ABIN4890007) Western Blot: IFRD1 Antibody [NBP1-52851] - Jurkat cell lysate, concentration 0.2-1 u...
Immunohistochemistry (IHC) image for anti-Interferon Related Developmental Regulator 1 (IFRD1) (N-Term) antibody (ABIN4890007) Immunohistochemistry: IFRD1 Antibody [NBP1-52851] - Human Adult Adrenal Observed Stai...
Did you look for something else?