DCAF4 antibody (DDB1 and CUL4 Associated Factor 4)

Details for Product anti-DCAF4 Antibody No. ABIN4890010, Supplier: Log in to see
  • Wdr21
  • 1110018E21Rik
  • WDR21
  • WDR21A
  • DDB1 and CUL4 associated factor 4
  • Dcaf4
  • DCAF4
This DCAF4 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to WDR21A(WD repeat domain 21A) The peptide sequence was selected from the middle region of WDR21A. Peptide sequence GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others DCAF4 products on genomics-online (e.g. as negative or positive controls)
Alternative Name DCAF4 (DCAF4 Antibody Abstract)
Background Gene Symbol: DCAF4
Molecular Weight Theoretical MW: 43 kDa
Gene ID 26094
UniProt Q8IV10
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against WDR21A and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-DDB1 and CUL4 Associated Factor 4 (DCAF4) antibody (ABIN4890010) Western Blot: DCAF4 Antibody [NBP1-52862] - Jurkat, Antibody Dilution: 1.0 ug/ml DCAF...
Western Blotting (WB) image for anti-DDB1 and CUL4 Associated Factor 4 (DCAF4) antibody (ABIN4890010) Western Blot: DCAF4 Antibody [NBP1-52862] - Human Muscle lysate, concentration 0.2-1 ...
Did you look for something else?