Creatine Kinase, Muscle (CKM) (N-Term) antibody

Details for Product No. ABIN4890011, Supplier: Log in to see
Antigen
  • CKMM
  • M-CK
  • Ckmm
  • MCK
  • ckmm
  • m-ck
  • CKM
  • CK-M
  • cb51
  • ckm
  • mck
  • wu:fa28d05
  • ckm3
  • wu:fb55e09
  • zgc:64204
  • zgc:92070
  • creatine kinase, M-type
  • creatine kinase, muscle
  • creatine kinase, M-type L homeolog
  • creatine kinase, muscle a
  • creatine kinase, muscle b
  • CKM
  • Ckm
  • ckm.L
  • ckm
  • ckma
  • ckmb
Epitope
N-Term
34
25
15
11
9
9
8
4
4
4
2
2
2
2
2
2
2
1
1
1
1
Reactivity
Human
335
98
73
20
16
8
7
7
6
5
4
2
2
1
1
1
1
Host
Rabbit
184
110
77
2
1
1
Clonality
Polyclonal
Conjugate
Un-conjugated
34
26
18
15
14
13
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
237
224
92
30
29
26
26
20
13
12
10
7
5
4
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to CKM(creatine kinase, muscle) The peptide sequence was selected from the N terminal of CKM. Peptide sequence VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL.
Purification Immunogen affinity purified
Antigen
Alternative Name Creatine Kinase, Muscle/CKMM (CKM Antibody Abstract)
Background Gene Symbol: CKM
Molecular Weight Theoretical MW: 43 kDa
Gene ID 1158
UniProt P06732
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CKM and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Creatine Kinase, Muscle (CKM) (N-Term) antibody (ABIN4890011) Western Blot: Creatine Kinase, Muscle/CKMM Antibody [NBP1-52863] - Human Muscle lysat...
Did you look for something else?